HORDB

ID: hor006481
Uniprot ID: Q9GLK4
Protein name: Brain natriuretic peptide 32
Gene name: NPPB
Organism: Felis catus (Cat) (Felis silvestris catus)
Family: Natriuretic peptide family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0051427 hormone receptor binding
GO BP: GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0019934 cGMP-mediated signaling; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence: SSKMMRDSRCFGRRLDRIGSLSGLGCNVLRRH
Length: 32(101-132)
Propeptide: MDPKTALLRALLLLLFLHLSPLGGRSHPLGGPGPASEASAIQELLDGLRDTVSELQEAQMALGPLQQGHSPAESWEAQEEPPARVLAPHDNVLRALRRLGSSKMMRDSRCFGRRLDRIGSLSGLGCNVLRRH
Signal peptide: MDPKTALLRALLLLLFLHLSPLGGRS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (By similarity). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in tur
Mechanism: NA
Cross BBB: NA
Target: NPR3, NPR1
Target Unid: M3W032, M3VZ19
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006481_AF2.pdb

hor006481_ESM.pdb

Mass:	421840	Formula:	C149H259N57O43S4
Absent amino acids:	AEPQTWY	Common amino acids:	R
pI:	12.12	Basic residues:	9
Polar residues:	12	Hydrophobic residues:	7
Hydrophobicity:	-60	Boman Index:	-11309
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	70
Instability Index:	8015.63	Extinction Coefficient cystines:	125
Absorbance 280nm:	4.03