HORDB

ID: hor006481
Uniprot ID: Q9GLK4
Protein name: Brain natriuretic peptide 32
Gene name: NPPB
Organism: Felis catus (Cat) (Felis silvestris catus)
Family: Natriuretic peptide family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0051427 hormone receptor binding
GO BP: GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0019934 cGMP-mediated signaling; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence: SSKMMRDSRCFGRRLDRIGSLSGLGCNVLRRH
Length: 32
Propeptide: MDPKTALLRALLLLLFLHLSPLGGRSHPLGGPGPASEASAIQELLDGLRDTVSELQEAQMALGPLQQGHSPAESWEAQEEPPARVLAPHDNVLRALRRLGSSKMMRDSRCFGRRLDRIGSLSGLGCNVLRRH
Signal peptide: MDPKTALLRALLLLLFLHLSPLGGRS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (By similarity). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses. Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Binds the clearance receptor NPR3 (By similarity).
Mechanism: NA
Cross BBB: NA
Target: NPR3, NPR1
Target Unid: M3W032, M3VZ19
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006481_AF2.pdb

hor006481_ESM.pdb

Mass:	421840	Formula:	C149H259N57O43S4
Absent amino acids:	AEPQTWY	Common amino acids:	R
pI:	12.12	Basic residues:	9
Polar residues:	12	Hydrophobic residues:	7
Hydrophobicity:	-60	Boman Index:	-11309
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	70
Instability Index:	8015.63	Extinction Coefficient cystines:	125
Absorbance 280nm:	4.03